Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD1 Peptide - N-terminal region

CBWD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COBP

UniProt

Q9BRT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBWD1 Rabbit Polyclonal Antibody (orb326794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138827

Preservative

Lyophilized powder

AA Sequence

GAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malaria TaqMan Probe/Primer and Control Set
TM34810 100 Reactions

Malaria TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
Human C7ORF29 (ZBED6CL) activation kit by CRISPRa
GA114417 1 Kit

Human C7ORF29 (ZBED6CL) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Unknown tissue
CR562973 5 µg

Tissue Total RNA, Unknown tissue

Sign In for Pricing
View Details
Ramp1 Mouse Gene Knockout Kit (CRISPR)
KN514450 1 Kit

Ramp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS515760 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
4-Chlorocinnamic Acid
TRC-C293310-250G 250 g

4-Chlorocinnamic Acid

Sign In for Pricing
View Details