Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD1 Peptide - N-terminal region

CBWD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

COBP

UniProt

Q9BRT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBWD1 Rabbit Polyclonal Antibody (orb326794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138827

Preservative

Lyophilized powder

AA Sequence

GAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COLEC12 activation kit by CRISPRa
GA113017 1 Kit

Human COLEC12 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human BAG3 protein (GST tag)
PDEH100827-01 20 µg

Recombinant Human BAG3 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human BAG3 protein (GST tag)
PDEH100827-02 100 µg

Recombinant Human BAG3 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human BAG3 protein (GST tag)
PDEH100827-03 500 µg

Recombinant Human BAG3 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human BAG3 protein (GST tag)
PDEH100827-04 1 mg

Recombinant Human BAG3 protein (GST tag)

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561449 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details