Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBFD1 Peptide - C-terminal region

UBFD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UBPH

UniProt

O14562

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBFD1 Rabbit Polyclonal Antibody (orb587095) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061989

Preservative

Lyophilized powder

AA Sequence

LSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOT6 (NM_001037162) Human Over-expression Lysate
LY400416 100 µg

ACOT6 (NM_001037162) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Secreted Frizzled Related Protein 4 (SFRP4) ELISA Kit
RD-SFRP4-Ra-01 96 Tests

Rat Secreted Frizzled Related Protein 4 (SFRP4) ELISA Kit

Sign In for Pricing
View Details
Rat Secreted Frizzled Related Protein 4 (SFRP4) ELISA Kit
RD-SFRP4-Ra-02 48 Tests

Rat Secreted Frizzled Related Protein 4 (SFRP4) ELISA Kit

Sign In for Pricing
View Details
Vmn2r86 Mouse Gene Knockout Kit (CRISPR)
KN519218 1 Kit

Vmn2r86 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)
KN216518 1 Kit

Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit
RD-COL1a2-Mu-01 96 Tests

Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details