Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBFD1 Peptide - C-terminal region

UBFD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UBPH

UniProt

O14562

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBFD1 Rabbit Polyclonal Antibody (orb587095) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061989

Preservative

Lyophilized powder

AA Sequence

LSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KDM3A / JHDM2A (KDM3A) activation kit by CRISPRa
GA110995 1 Kit

Human KDM3A / JHDM2A (KDM3A) activation kit by CRISPRa

Sign In for Pricing
View Details
Collagen XI alpha 2 (COL11A2) (NM_001163771) Human Over-expression Lysate
LC431254 20 µg

Collagen XI alpha 2 (COL11A2) (NM_001163771) Human Over-expression Lysate

Sign In for Pricing
View Details
KCC2 (SLC12A5) (NM_020708) Human Over-expression Lysate
LC402800 20 µg

KCC2 (SLC12A5) (NM_020708) Human Over-expression Lysate

Sign In for Pricing
View Details
Desmin Polyclonal Antibody
E-AB-40571-01 25 µL

Desmin Polyclonal Antibody

Sign In for Pricing
View Details
Desmin Polyclonal Antibody
E-AB-40571-02 100 µL

Desmin Polyclonal Antibody

Sign In for Pricing
View Details
NG2 Recombinant Rabbit monoclonal Antibody
HA723167 100 µL

NG2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details