Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERTAD4 Peptide - C-terminal region

SERTAD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ667H12.2

UniProt

Q9NUC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERTAD4 Rabbit Polyclonal Antibody (orb587097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062551

Preservative

Lyophilized powder

AA Sequence

VGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRMS1L Protein Vector (Human) (pPM-C-HA)
13485021 500 ng

BRMS1L Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
3-Methyl-1- (2-pyridinyl) -2-butanone
OR1080085 1 Each

3-Methyl-1- (2-pyridinyl) -2-butanone

Sign In for Pricing
View Details
Glutathione (MaxLight 405)
MBS6478258-01 0.1 mL

Glutathione (MaxLight 405)

Sign In for Pricing
View Details
Glutathione (MaxLight 405)
MBS6478258-02 5x 0.1 mL

Glutathione (MaxLight 405)

Sign In for Pricing
View Details
α-tubulin Monoclonal Antibody (8F11), AbFluor™ 680 Conjugated
RA12209-01 50 µL

α-tubulin Monoclonal Antibody (8F11), AbFluor™ 680 Conjugated

Sign In for Pricing
View Details
α-tubulin Monoclonal Antibody (8F11), AbFluor™ 680 Conjugated
RA12209-02 100 µL

α-tubulin Monoclonal Antibody (8F11), AbFluor™ 680 Conjugated

Sign In for Pricing
View Details