Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERTAD4 Peptide - C-terminal region

SERTAD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ667H12.2

UniProt

Q9NUC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERTAD4 Rabbit Polyclonal Antibody (orb587097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062551

Preservative

Lyophilized powder

AA Sequence

VGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL28P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV779200 1.0 µg DNA

RPL28P5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
SYNC (NM_001161708) Human Tagged Lenti ORF Clone
RC228394L4 10 µg

SYNC (NM_001161708) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)
MBS2098411-01 5x 96 Tests

Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)
MBS2098411-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)
MBS2098411-03 10x 96 Tests

Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)
MBS2098411-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rhesus monkey Macrophage Inflammatory Protein 1 Beta (MIP1b) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details