Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf44 Peptide - N-terminal region

C8orf44 Peptide - N-terminal region

Product Specifications

UniProt

Q96CB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf44 Rabbit Polyclonal Antibody (orb587098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062553

Preservative

Lyophilized powder

AA Sequence

HWKGRARWLMPVIPALWEAKAGRSPEVRSSKPAWPTWRNPIFTKNTKISQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Gli1 (T101/ S102/S104) Rabbit Polyclonal Antibody (BF750)
orb2443369 100 µL

Phospho-Gli1 (T101/ S102/S104) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
P2RY1 Antibody - N-terminal region
ARP51293_P050-25UL 25 µL

P2RY1 Antibody - N-terminal region

Sign In for Pricing
View Details
SHPK Protein Vector (Human) (pPB-C-His)
PV038033 500 ng

SHPK Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
C11orf39-set siRNA/shRNA/RNAi Lentivector (Human)
13689091 4x 500 ng

C11orf39-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Gm13718 3'UTR Lenti-reporter-Luc Vector
21826084 1.0 µg

Gm13718 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TAAR1 CRISPRa sgRNA lentivector (set of three targets)(Human)
46021121 3x 1.0µg DNA

TAAR1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details