Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf44 Peptide - N-terminal region

C8orf44 Peptide - N-terminal region

Product Specifications

UniProt

Q96CB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf44 Rabbit Polyclonal Antibody (orb587098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062553

Preservative

Lyophilized powder

AA Sequence

HWKGRARWLMPVIPALWEAKAGRSPEVRSSKPAWPTWRNPIFTKNTKISQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Agfg2 Mouse siRNA Oligo Duplex (Locus ID 231801)
SR408336 1 Kit

Agfg2 Mouse siRNA Oligo Duplex (Locus ID 231801)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque OR4K5 Protein, His (Fc)-Avi-tagged
OR4K5-3027R 50 µg

Recombinant Rhesus Macaque OR4K5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mmu-miR-6952-3p miRNA Mimic
orb1874795-01 5 nmol

Mmu-miR-6952-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6952-3p miRNA Mimic
orb1874795-02 10 nmol

Mmu-miR-6952-3p miRNA Mimic

Sign In for Pricing
View Details
Anti-CD45
DB042RTU-7 7 ml

Anti-CD45

Sign In for Pricing
View Details
AMPA Receptor 2  polyclonal antibody
BZ17044 50ul

AMPA Receptor 2 polyclonal antibody

Sign In for Pricing
View Details