Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZD4 Peptide - C-terminal region

PDZD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LU1, PDZK4, PDZRN4L

UniProt

Q76G19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZD4 Rabbit Polyclonal Antibody (orb587101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115901

Preservative

Lyophilized powder

AA Sequence

AGRRQHAEERGRRNPKTGLTLERVGPESSPYLSRRHRGQGQEGEHYHSCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Tendon
CS543635 5x 5 µm

Frozen Tissue Sections, Tendon

Sign In for Pricing
View Details
Human Hematopoietic cell signal transducer, HCST ELISA KIT
ELI-30897h 96 Tests

Human Hematopoietic cell signal transducer, HCST ELISA KIT

Sign In for Pricing
View Details
Mouse Structural maintenance of chromosomes protein 6 (SMC6) ELISA Kit
abx546221 96 Tests

Mouse Structural maintenance of chromosomes protein 6 (SMC6) ELISA Kit

Sign In for Pricing
View Details
LDOC1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1206506 1.0 µg DNA

LDOC1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
POTEJ siRNA (Human)
MBS8220640-01 15 nmol

POTEJ siRNA (Human)

Sign In for Pricing
View Details
POTEJ siRNA (Human)
MBS8220640-02 30 nmol

POTEJ siRNA (Human)

Sign In for Pricing
View Details