Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZD4 Peptide - C-terminal region

PDZD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LU1, PDZK4, PDZRN4L

UniProt

Q76G19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZD4 Rabbit Polyclonal Antibody (orb587101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115901

Preservative

Lyophilized powder

AA Sequence

AGRRQHAEERGRRNPKTGLTLERVGPESSPYLSRRHRGQGQEGEHYHSCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FBL Pre-designed siRNA Set A
SI005500A 1 Each

Human FBL Pre-designed siRNA Set A

Sign In for Pricing
View Details
LRRTM4 sgRNA CRISPR Lentivector (Human) (Target 2)
K1239803 1.0 µg DNA

LRRTM4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
IGKV1-32 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV764767 1.0 µg DNA

IGKV1-32 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Cdh10 AAV siRNA Pooled Vector
15648164 1.0 µg

Cdh10 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SGSM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
43642066 1.0 µg DNA

SGSM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BC030500 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4241006 1.0 µg DNA

BC030500 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details