Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD36B Peptide - C-terminal region

ANKRD36B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1641

UniProt

Q8N2N9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD36B Rabbit Polyclonal Antibody (orb326798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079466

Preservative

Lyophilized powder

AA Sequence

LLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal sequence receptor delta (SSR4) (NM_006280) Human Tagged ORF Clone Lentiviral Particle
RC201593L4V 200 µL

Signal sequence receptor delta (SSR4) (NM_006280) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RAB5B monoclonal antibody
orb1677115-01 50 µL

RAB5B monoclonal antibody

Sign In for Pricing
View Details
RAB5B monoclonal antibody
orb1677115-02 100 µL

RAB5B monoclonal antibody

Sign In for Pricing
View Details
RAB5B monoclonal antibody
orb1677115-03 200 µL

RAB5B monoclonal antibody

Sign In for Pricing
View Details
ZRANB1 Human Over-expression Lysate
orb1349100 100 µg

ZRANB1 Human Over-expression Lysate

Sign In for Pricing
View Details
Gramine
S2304-50mg 50 mg

Gramine

Sign In for Pricing
View Details