Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD36B Peptide - C-terminal region

ANKRD36B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1641

UniProt

Q8N2N9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD36B Rabbit Polyclonal Antibody (orb326798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079466

Preservative

Lyophilized powder

AA Sequence

LLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRP2/DCT Rabbit Polyclonal Antibody (Fluoro550)
orb3112501 100 µg

TRP2/DCT Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)
MBS1360804-01 0.02 mg (E-Coli)

Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)
MBS1360804-02 0.1 mg (E-Coli)

Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)
MBS1360804-03 0.02 mg (Yeast)

Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)
MBS1360804-04 0.1 mg (Yeast)

Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)
MBS1360804-05 0.02 mg (Baculovirus)

Recombinant Pseudoalteromonas haloplanktis Maf-like protein PSHAa1813 (PSHAa1813)

Sign In for Pricing
View Details