Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMBIM1 Peptide - N-terminal region

TMBIM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LFG3, MST100, MSTP100, RECS1

UniProt

Q969X1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMBIM1 Rabbit Polyclonal Antibody (orb587107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071435

Preservative

Lyophilized powder

AA Sequence

GYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB Recombinant Rabbit Monoclonal Antibody [SA04-04]
ET1601-15 100 µL

CREB Recombinant Rabbit Monoclonal Antibody [SA04-04]

Sign In for Pricing
View Details
Air Cooled Chiller BCHI-106
BCHI-106 Each

Air Cooled Chiller BCHI-106

Sign In for Pricing
View Details
Chrd Mouse Gene Knockout Kit (CRISPR)
KN503295 1 Kit

Chrd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARSH (NM_001011719) Human Over-expression Lysate
LY423302 100 µg

ARSH (NM_001011719) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), 1mg/mL
BNUM2406-50 1x 50 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), 1mg/mL

Sign In for Pricing
View Details
SnoN (SKIL) Rabbit Polyclonal Antibody
TA381523 100 µL

SnoN (SKIL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details