Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMBIM1 Peptide - N-terminal region

TMBIM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LFG3, MST100, MSTP100, RECS1

UniProt

Q969X1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMBIM1 Rabbit Polyclonal Antibody (orb587107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071435

Preservative

Lyophilized powder

AA Sequence

GYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RET Mouse Monoclonal Antibody [Clone ID: 8D10C9]
AM06194SU-N 100 µL

RET Mouse Monoclonal Antibody [Clone ID: 8D10C9]

Sign In for Pricing
View Details
Chicoric Acid
TRC-C291970-25MG 25 mg

Chicoric Acid

Sign In for Pricing
View Details
Medroxy Progesterone
TRC-M203550-250MG 250 mg

Medroxy Progesterone

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS700028 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
ZMPSTE24 (Center) Rabbit Polyclonal Antibody
AP12190PU-N 400 µL

ZMPSTE24 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UC-01 25 µg

FITC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details