Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS26 Peptide - C-terminal region

MRPS26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf193, GI008, MRP-S13, MRP-S26, MRPS13, NY-BR-87, RPMS13, dJ534B8.3

UniProt

Q9BYN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS26 Rabbit Polyclonal Antibody (orb587110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110438

Preservative

Lyophilized powder

AA Sequence

RQALEQARKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Morpholin-4-yl-1,3,4-thiadiazole-2-thiol
sc-284676 1 g

5-Morpholin-4-yl-1,3,4-thiadiazole-2-thiol

Sign In for Pricing
View Details
PRCP Polyclonal Antibody, Cy3 Conjugated
bs-1873R-Cy3-01 20 µL

PRCP Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
PRCP Polyclonal Antibody, Cy3 Conjugated
bs-1873R-Cy3-02 100 µL

PRCP Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Cat Soluble Glycoprotein VI (SGPVI) ELISA Kit
MBS9390133 Inquire

Cat Soluble Glycoprotein VI (SGPVI) ELISA Kit

Sign In for Pricing
View Details
DLG3 polyclonal antibody
BS76965-01 50 µL

DLG3 polyclonal antibody

Sign In for Pricing
View Details
DLG3 polyclonal antibody
BS76965-02 100 µL

DLG3 polyclonal antibody

Sign In for Pricing
View Details