Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS26 Peptide - C-terminal region

MRPS26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf193, GI008, MRP-S13, MRP-S26, MRPS13, NY-BR-87, RPMS13, dJ534B8.3

UniProt

Q9BYN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS26 Rabbit Polyclonal Antibody (orb587110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110438

Preservative

Lyophilized powder

AA Sequence

RQALEQARKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZD9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2374603 100 µL

PDZD9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
DCST2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0566903 1.0 µg DNA

DCST2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
SIPB741Mu02-01 10 µg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
SIPB741Mu02-02 50 µg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
SIPB741Mu02-03 200 µg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details
Recombinant Involucrin (INV)
SIPB741Mu02-04 1 mg

Recombinant Involucrin (INV)

Sign In for Pricing
View Details