Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS26 Peptide - C-terminal region

MRPS26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf193, GI008, MRP-S13, MRP-S26, MRPS13, NY-BR-87, RPMS13, dJ534B8.3

UniProt

Q9BYN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS26 Rabbit Polyclonal Antibody (orb587111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110438

Preservative

Lyophilized powder

AA Sequence

LMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fetuin A (AHSG) (NM_001622) Human Over-expression Lysate
LC400610 20 µg

Fetuin A (AHSG) (NM_001622) Human Over-expression Lysate

Sign In for Pricing
View Details
Hydrocortisone 17-Valerate
TRC-H714740-10G 10 g

Hydrocortisone 17-Valerate

Sign In for Pricing
View Details
NK TR protein (NKTR) Human Gene Knockout Kit (CRISPR)
KN417598 1 Kit

NK TR protein (NKTR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Succinimidyl 3-iodobenzoate
TRC-S830285-100MG 100 mg

Succinimidyl 3-iodobenzoate

Sign In for Pricing
View Details
1,4-Butanediol Diglycidyl Ether
TRC-B701365-1G 1 g

1,4-Butanediol Diglycidyl Ether

Sign In for Pricing
View Details
Sucrose Microplate Assay Kit
RDSM036 100 Assays

Sucrose Microplate Assay Kit

Sign In for Pricing
View Details