Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS26 Peptide - C-terminal region

MRPS26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf193, GI008, MRP-S13, MRP-S26, MRPS13, NY-BR-87, RPMS13, dJ534B8.3

UniProt

Q9BYN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS26 Rabbit Polyclonal Antibody (orb587111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110438

Preservative

Lyophilized powder

AA Sequence

LMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hHR23b (RAD23B) Rabbit Monoclonal Antibody [Clone ID: SAIC-28B-8]
TA385902 200 µg

hHR23b (RAD23B) Rabbit Monoclonal Antibody [Clone ID: SAIC-28B-8]

Sign In for Pricing
View Details
ZBTB8A Polyclonal Antibody
E-AB-18720-01 20 µL

ZBTB8A Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB8A Polyclonal Antibody
E-AB-18720-02 60 µL

ZBTB8A Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB8A Polyclonal Antibody
E-AB-18720-03 120 µL

ZBTB8A Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB8A Polyclonal Antibody
E-AB-18720-04 200 µL

ZBTB8A Polyclonal Antibody

Sign In for Pricing
View Details
MLKL Rabbit Monoclonal Antibody
TA422499 100 µL

MLKL Rabbit Monoclonal Antibody

Sign In for Pricing
View Details