Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf33 Peptide - C-terminal region

C8orf33 Peptide - C-terminal region

Product Specifications

UniProt

Q9H7E9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf33 Rabbit Polyclonal Antibody (orb587115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075568

Preservative

Lyophilized powder

AA Sequence

WREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Gossypium barbadense (Sea-island cotton)(Egyptian cotton) PSBT Polyclonal Antibody
MBS7166817 Inquire

Rabbit anti-Gossypium barbadense (Sea-island cotton)(Egyptian cotton) PSBT Polyclonal Antibody

Sign In for Pricing
View Details
RT4I1, CT (RTN4IP1, NIMP, Reticulon-4-interacting protein 1, mitochondrial, NOGO-interacting mitochondrial protein) (FITC) discontinued
041315-FITC 200 µL

RT4I1, CT (RTN4IP1, NIMP, Reticulon-4-interacting protein 1, mitochondrial, NOGO-interacting mitochondrial protein) (FITC) discontinued

Sign In for Pricing
View Details
PLAUR Polyclonal Antibody
E-AB-40370-01 20 µL

PLAUR Polyclonal Antibody

Sign In for Pricing
View Details
PLAUR Polyclonal Antibody
E-AB-40370-02 60 µL

PLAUR Polyclonal Antibody

Sign In for Pricing
View Details
PLAUR Polyclonal Antibody
E-AB-40370-03 120 µL

PLAUR Polyclonal Antibody

Sign In for Pricing
View Details
PLAUR Polyclonal Antibody
E-AB-40370-04 200 µL

PLAUR Polyclonal Antibody

Sign In for Pricing
View Details