Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA5L1 Peptide - C-terminal region

SPATA5L1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BVQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA5L1 Rabbit Polyclonal Antibody (orb587116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076968

Preservative

Lyophilized powder

AA Sequence

CDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEVFNRSVMIIAATN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 (PE)
C2392-03J 100 Tests

CD40 (PE)

Sign In for Pricing
View Details
Mouse Hepatoma Derived Growth Factor (HDGF) CLIA Kit
abx491778-01 96 Tests

Mouse Hepatoma Derived Growth Factor (HDGF) CLIA Kit

Sign In for Pricing
View Details
Mouse Hepatoma Derived Growth Factor (HDGF) CLIA Kit
abx491778-02 5x 96 Tests

Mouse Hepatoma Derived Growth Factor (HDGF) CLIA Kit

Sign In for Pricing
View Details
Mouse Hepatoma Derived Growth Factor (HDGF) CLIA Kit
abx491778-03 10x 96 Tests

Mouse Hepatoma Derived Growth Factor (HDGF) CLIA Kit

Sign In for Pricing
View Details
Rabbit costimulatory molecules recptor ELISA kit
GTR10435859 96 Well

Rabbit costimulatory molecules recptor ELISA kit

Sign In for Pricing
View Details
Human ROR1 (838-937) Protein, hFc Tag
MBS1883942-01 0.01 mg

Human ROR1 (838-937) Protein, hFc Tag

Sign In for Pricing
View Details