Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA5L1 Peptide - C-terminal region

SPATA5L1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BVQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA5L1 Rabbit Polyclonal Antibody (orb587116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076968

Preservative

Lyophilized powder

AA Sequence

CDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEVFNRSVMIIAATN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A10 HDR Plasmid (m)
sc-424002-HDR 20 µg

Annexin A10 HDR Plasmid (m)

Sign In for Pricing
View Details
Human GPR12 Alexa Fluor 405 Antibody (Clone 584940)
FAB6738V-100UG 100 µg

Human GPR12 Alexa Fluor 405 Antibody (Clone 584940)

Sign In for Pricing
View Details
Raf-1 (phospho Ser301) rabbit pAb
ES6978-01 50 µL

Raf-1 (phospho Ser301) rabbit pAb

Sign In for Pricing
View Details
Raf-1 (phospho Ser301) rabbit pAb
ES6978-02 100 µL

Raf-1 (phospho Ser301) rabbit pAb

Sign In for Pricing
View Details
Stx6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3536505 3x 1.0 µg

Stx6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Beta-Amyloid Peptide (12C3) Antibody
250436 0.2 mg

Beta-Amyloid Peptide (12C3) Antibody

Sign In for Pricing
View Details