Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf49 Peptide - middle region

C2orf49 Peptide - middle region

Product Specifications

Product Name Alternative

Asw

UniProt

Q9BVC5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2orf49 Rabbit Polyclonal Antibody (orb587119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076998

Preservative

Lyophilized powder

AA Sequence

VDGLRKRPLIVFDGSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFRKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL
BNC401467-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Biopterin
TRC-D016580-75MG 75 mg

D-Biopterin

Sign In for Pricing
View Details
Human GLT8D2 activation kit by CRISPRa
GA113181 1 Kit

Human GLT8D2 activation kit by CRISPRa

Sign In for Pricing
View Details
AzoDye-2 CPG (1000 A)
2430-AAT 100 mg

AzoDye-2 CPG (1000 A)

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL
BNC402175-100 1x 100 µL

Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS707413 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details