Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf49 Peptide - middle region

C2orf49 Peptide - middle region

Product Specifications

Product Name Alternative

Asw

UniProt

Q9BVC5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C2orf49 Rabbit Polyclonal Antibody (orb587119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076998

Preservative

Lyophilized powder

AA Sequence

VDGLRKRPLIVFDGSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFRKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vacuum Oven BOVA-5903
BOVA-5903 1 Unit

Vacuum Oven BOVA-5903

Sign In for Pricing
View Details
EXOC1 (NM_001024924) Human Over-expression Lysate
LC422553 20 µg

EXOC1 (NM_001024924) Human Over-expression Lysate

Sign In for Pricing
View Details
Regucalcin (RGN) (NM_001282849) Human Tagged ORF Clone
RG236723 10 µg

Regucalcin (RGN) (NM_001282849) Human Tagged ORF Clone

Sign In for Pricing
View Details
6-TAMRA Cadaverine, Trifluoroacetate Salt
#90122 1x 5 mg

6-TAMRA Cadaverine, Trifluoroacetate Salt

Sign In for Pricing
View Details
CD147 (8D6), CF488A conjugate, 0.1mg/mL
BNC880424-100 1x 100 µL

CD147 (8D6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sterebin A
TRC-S213270-5MG 5 mg

Sterebin A

Sign In for Pricing
View Details