Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMT1 Peptide - N-terminal region

ARMT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf211

UniProt

Q9H993

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMT1 Rabbit Polyclonal Antibody (orb587128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078849

Preservative

Lyophilized powder

AA Sequence

SDGKSRWFYSPWLLVECYMYRRIHEAIIQSPPIDYFDVFKESKEQNFYGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD37 (NM_001774) Human Over-expression Lysate
LC419751 20 µg

CD37 (NM_001774) Human Over-expression Lysate

Sign In for Pricing
View Details
Botulinum Neurotoxin E Heavy Chain MAb (Clone 785208)
MAB7135-SP 25 µg

Botulinum Neurotoxin E Heavy Chain MAb (Clone 785208)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)
MBS2054758-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)
MBS2054758-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)
MBS2054758-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)
MBS2054758-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Protease, Serine 12 (PRSS12)

Sign In for Pricing
View Details