Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC121 Peptide - middle region

CCDC121 Peptide - middle region

Product Specifications

UniProt

J3KQZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC121 Rabbit Polyclonal Antibody (orb326805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136155

Preservative

Lyophilized powder

AA Sequence

ENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQIS

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAL mL5 Antibody
E94766 100 µg

CAL mL5 Antibody

Sign In for Pricing
View Details
OR10D5P Protein Vector (Human) (pPB-C-His)
PV105842 500 ng

OR10D5P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
SULT2A1 Conjugated Antibody
orb1611182 100 µL

SULT2A1 Conjugated Antibody

Sign In for Pricing
View Details
ZAK (MAP3K20) (NM_016653) Human Over-expression Lysate
LS051776 100 µg

ZAK (MAP3K20) (NM_016653) Human Over-expression Lysate

Sign In for Pricing
View Details
CBFA2T3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
15103064 1.0 µg DNA

CBFA2T3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
EPHB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0687207 1.0 µg DNA

EPHB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details