CCDC121 Peptide - middle region
CCDC121 Peptide - middle region
Product Specifications
UniProt
J3KQZ8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC121 Rabbit Polyclonal Antibody (orb326805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001136155
Preservative
Lyophilized powder
AA Sequence
ENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQIS
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx270067-01 50 Tests
CD70 Antigen / Tumor Necrosis Factor Ligand Superfamily Member 7 (CD70) Antibody
Sign In for Pricing
View Details abx270067-02 100 Tests
CD70 Antigen / Tumor Necrosis Factor Ligand Superfamily Member 7 (CD70) Antibody
Sign In for Pricing
View Details abx270067-03 200 Tests
CD70 Antigen / Tumor Necrosis Factor Ligand Superfamily Member 7 (CD70) Antibody
Sign In for Pricing
View Details abx270067-04 500 Tests
CD70 Antigen / Tumor Necrosis Factor Ligand Superfamily Member 7 (CD70) Antibody
Sign In for Pricing
View Details 