Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC7 Peptide - N-terminal region

ARMC7 Peptide - N-terminal region

Product Specifications

UniProt

Q9H6L4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC7 Rabbit Polyclonal Antibody (orb587131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078861

Preservative

Lyophilized powder

AA Sequence

MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 / MIC2 (Ewing's Sarcoma Marker), CF740 conjugate, 0.1mg/mL
BNC741646-100 1x 100 µL

CD99 / MIC2 (Ewing's Sarcoma Marker), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DEFB127 activation kit by CRISPRa
GA115419 1 Kit

Human DEFB127 activation kit by CRISPRa

Sign In for Pricing
View Details
PE Anti-Mouse CD14 Antibody
RD21940F-01 25 µg

PE Anti-Mouse CD14 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD14 Antibody
RD21940F-02 100 µg

PE Anti-Mouse CD14 Antibody

Sign In for Pricing
View Details
Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin
ICH1037-100mg 100 mg

Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701768 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details