Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC7 Peptide - N-terminal region

ARMC7 Peptide - N-terminal region

Product Specifications

UniProt

Q9H6L4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC7 Rabbit Polyclonal Antibody (orb587131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078861

Preservative

Lyophilized powder

AA Sequence

MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NYX activation kit by CRISPRa
GA111864 1 Kit

Human NYX activation kit by CRISPRa

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF740 conjugate, 0.1mg/mL
BNC740597-500 1x 500 µL

Alkaline Phosphatase (ALPL/597), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rb (RB1) pSer780 Rabbit Polyclonal Antibody
AP01675PU-N 100 µg

Rb (RB1) pSer780 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-2 (8C8), CF405S conjugate, 0.1mg/mL
BNC040005-100 1x 100 µL

Bcl-2 (8C8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS712020 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
FKRP (NM_001039885) Human Over-expression Lysate
LC421845 20 µg

FKRP (NM_001039885) Human Over-expression Lysate

Sign In for Pricing
View Details