Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSANTD2 Peptide - N-terminal region

MSANTD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf61

UniProt

Q6P1R3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSANTD2 Rabbit Polyclonal Antibody (orb587133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078907

Preservative

Lyophilized powder

AA Sequence

LAELGYERTPSQCRERIKELESDGSTMEDYSQEDWGNHSQDLHGYPTDQE

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloro-1- (1,1-dimethylethyl) naphthalene
JH920599 1 Each

3-Chloro-1- (1,1-dimethylethyl) naphthalene

Sign In for Pricing
View Details
IGFBPL1 (NM_001007563) Human Tagged ORF Clone Lentiviral Particle
RC219122L2V 200 µL

IGFBPL1 (NM_001007563) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LARP6 (NM_197958) Human Over-expression Lysate
LS055323-20ug 20 µg

LARP6 (NM_197958) Human Over-expression Lysate

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-5692b Virus
mh6992 1.0 mL

AdmiRa-Off-hsa-miR-5692b Virus

Sign In for Pricing
View Details
Recombinant Streptococcus mutans Aspartate--tRNA ligase 2 (aspS2), partial
MBS1405563 Inquire

Recombinant Streptococcus mutans Aspartate--tRNA ligase 2 (aspS2), partial

Sign In for Pricing
View Details
Il1rl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
24854116 3x 1.0 µg

Il1rl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details