Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSANTD2 Peptide - N-terminal region

MSANTD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf61

UniProt

Q6P1R3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSANTD2 Rabbit Polyclonal Antibody (orb587133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078907

Preservative

Lyophilized powder

AA Sequence

LAELGYERTPSQCRERIKELESDGSTMEDYSQEDWGNHSQDLHGYPTDQE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smc3 (BC057345) Mouse Tagged ORF Clone Lentiviral Particle
MR209999L1V 200 µL

Smc3 (BC057345) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HPLC Column, PFP,5μm,120Å,4.0x150mm
13021301 1 PC

HPLC Column, PFP,5μm,120Å,4.0x150mm

Sign In for Pricing
View Details
ZSCAN29-set siRNA/shRNA/RNAi Lentivector (Human)
51969091 4x 500 ng

ZSCAN29-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
STFR W021-297x105-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
829442 1 Card (1 Panel (s) x 1 Pack)

STFR W021-297x105-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rabbit Immunoglobulin Transcription Factor 1
GTR10401213 96 Well

Rabbit Immunoglobulin Transcription Factor 1

Sign In for Pricing
View Details
TLX3 Recombinant Protein Antigen
NBP2-68767PEP 100 µL

TLX3 Recombinant Protein Antigen

Sign In for Pricing
View Details