Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHCBP1 Peptide - C-terminal region

SHCBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAL

UniProt

Q8NEM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHCBP1 Rabbit Polyclonal Antibody (orb587137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079021

Preservative

Lyophilized powder

AA Sequence

IPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin-31; IL-31 Protein (C-His, Human)
P516437 100 µg

Interleukin-31; IL-31 Protein (C-His, Human)

Sign In for Pricing
View Details
L-α-Phosphatidyl-D-myo-inositol 3-monophosphate, dioctanoyl
sc-300867 100 µg

L-α-Phosphatidyl-D-myo-inositol 3-monophosphate, dioctanoyl

Sign In for Pricing
View Details
LOC100039015 3'UTR GFP Stable Cell Line
TU161140 1.0 mL

LOC100039015 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Olfr1199 Protein Vector (Mouse) (pPM-C-HA)
PV208504 500 ng

Olfr1199 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Thioredoxin Reductase 1 polyclonal antibody
BZ16838-01 50 µL

Thioredoxin Reductase 1 polyclonal antibody

Sign In for Pricing
View Details
Thioredoxin Reductase 1 polyclonal antibody
BZ16838-02 100 µL

Thioredoxin Reductase 1 polyclonal antibody

Sign In for Pricing
View Details