Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHCBP1 Peptide - C-terminal region

SHCBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAL

UniProt

Q8NEM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHCBP1 Rabbit Polyclonal Antibody (orb587137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079021

Preservative

Lyophilized powder

AA Sequence

IPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAEDGTEENKALKIQTSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromo-N, N-diethylpyrimidin-2-amine
OR1037872-01 25 g

5-Bromo-N, N-diethylpyrimidin-2-amine

Sign In for Pricing
View Details
5-Bromo-N, N-diethylpyrimidin-2-amine
OR1037872-02 100 g

5-Bromo-N, N-diethylpyrimidin-2-amine

Sign In for Pricing
View Details
Elotuzumab (anti-SLAMF7)
C00033-1mg*5 5x 1mg

Elotuzumab (anti-SLAMF7)

Sign In for Pricing
View Details
Human UTP15 activation kit by CRISPRa
GA113387 1 Kit

Human UTP15 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Aconitase 1 Antibody
MBS8242359-01 0.03 mL

Anti-Aconitase 1 Antibody

Sign In for Pricing
View Details
Anti-Aconitase 1 Antibody
MBS8242359-02 0.05 mL

Anti-Aconitase 1 Antibody

Sign In for Pricing
View Details