Tcf3 Peptide - C-terminal region
Tcf3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Pan2, Tcfe2a
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tcf3 Rabbit Polyclonal Antibody (orb573705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
P21677
Preservative
Lyophilized powder
AA Sequence
ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MLC1SA (MYL6B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B11]](https://cdn.genprice.uk/products/937/6868c40a994c49e6dc40502a/imageurl/ta811276am.webp)
TA811276AM 100 µL
MLC1SA (MYL6B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B11]
Sign In for Pricing
View Details 
BNC942343-500 1x 500 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY431207 100 µg
Endomucin (EMCN) (NM_001159694) Human Over-expression Lysate
Sign In for Pricing
View Details 