Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Supt4h1 Peptide - middle region

Supt4h1 Peptide - middle region

Product Specifications

Product Name Alternative

Supt4h2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Supt4h1 Rabbit Polyclonal Antibody (orb324615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

B5DEM7

Preservative

Lyophilized powder

AA Sequence

FDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces Pombe SPAC11D3.03c Protein (aa 1-302)
VAng-Yyj6105-1mgEcoli 1 mg (E. coli)

Recombinant Schizosaccharomyces Pombe SPAC11D3.03c Protein (aa 1-302)

Sign In for Pricing
View Details
Human Bruton'S Tyrosine Kinase (Btk) ELISA Kit
RDR-Btk-Hu-48Tests 48 Tests

Human Bruton'S Tyrosine Kinase (Btk) ELISA Kit

Sign In for Pricing
View Details
CDRT2 Recombinant Protein (Human)
RP051478 100 µg

CDRT2 Recombinant Protein (Human)

Sign In for Pricing
View Details
TRHDE Rabbit pAb
E45R17924N-50 50 µL

TRHDE Rabbit pAb

Sign In for Pricing
View Details
NUDT6 Over-expression Lysate Product
GWB-24C5A7 0.1 mg

NUDT6 Over-expression Lysate Product

Sign In for Pricing
View Details
SENP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43374061 1.0 µg DNA

SENP5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details