Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Supt4h1 Peptide - middle region

Supt4h1 Peptide - middle region

Product Specifications

Product Name Alternative

Supt4h2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Supt4h1 Rabbit Polyclonal Antibody (orb324615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

B5DEM7

Preservative

Lyophilized powder

AA Sequence

FDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh3glb1 Blocking Peptide
33R-4440 0.1 mg

Sh3glb1 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae tusA Protein (aa 1-81)
VAng-Cr5496-1mgEcoli 1 mg (E. coli)

Recombinant Klebsiella Pneumoniae tusA Protein (aa 1-81)

Sign In for Pricing
View Details
MED29 Protein Lysate (Human) with C-Ha Tag
28313031 100 µg

MED29 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
OR7E111P sgRNA CRISPR Lentivector set (Human)
K1538801 3x 1.0 µg

OR7E111P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
NFAM1 (NM_145912) Human Tagged ORF Clone
RG207824 10 µg

NFAM1 (NM_145912) Human Tagged ORF Clone

Sign In for Pricing
View Details
Fnbp1 (NM_001177649) Mouse Tagged Lenti ORF Clone
MR225094L4 10 µg

Fnbp1 (NM_001177649) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details