Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp12 Peptide - N-terminal region

Usp12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ubh1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Usp12 Rabbit Polyclonal Antibody (orb582902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q9D9M2

Preservative

Lyophilized powder

AA Sequence

HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MaxLight 490) discontinued
C2418-04-ML490 100 µL

CD63 (MaxLight 490) discontinued

Sign In for Pricing
View Details
TMEM161A Protein Vector (Rat) (pPM-C-HA)
PV311436 500 ng

TMEM161A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human ELOVL4 sgRNA gene knockout kit - Lentiviral human ELOVL4 sgRNA gene knockout kit (25)
GTR15364059 1 Vial

Lentiviral human ELOVL4 sgRNA gene knockout kit - Lentiviral human ELOVL4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Uracil Supplement, 5.6mg/mL
40121138-1 25 mL

Uracil Supplement, 5.6mg/mL

Sign In for Pricing
View Details
Canine Tumor necrosis Factor Receptor superfamily member 5, CD40/TNFRSF5 GENLISA ELISA
KLN0084 96 Well

Canine Tumor necrosis Factor Receptor superfamily member 5, CD40/TNFRSF5 GENLISA ELISA

Sign In for Pricing
View Details
Anti-Mouse IL24 Antibody (Fs0358)
RMG37010 100 μg

Anti-Mouse IL24 Antibody (Fs0358)

Sign In for Pricing
View Details