Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GK Peptide - N-terminal region

GK Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gyk, D930012N15Rik

UniProt

Q3TEN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GK Rabbit Polyclonal Antibody (orb326059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_032220

Preservative

Lyophilized powder

AA Sequence

DKVTGEPLYNAVVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPC142 (BABAM1) (NM_001033549) Human Over-expression Lysate
LC422382 20 µg

HSPC142 (BABAM1) (NM_001033549) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Genomic DNA, Esophagus
CD563416 5 µg

Tissue Genomic DNA, Esophagus

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS622630 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
OPN Polyclonal Antibody
AN005950L-01 25 µL

OPN Polyclonal Antibody

Sign In for Pricing
View Details
OPN Polyclonal Antibody
AN005950L-02 100 µL

OPN Polyclonal Antibody

Sign In for Pricing
View Details
ROR1 (NM_005012) Human Over-expression Lysate
LC401558 20 µg

ROR1 (NM_005012) Human Over-expression Lysate

Sign In for Pricing
View Details