Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GK Peptide - N-terminal region

GK Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gyk, D930012N15Rik

UniProt

Q3TEN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GK Rabbit Polyclonal Antibody (orb326059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_032220

Preservative

Lyophilized powder

AA Sequence

DKVTGEPLYNAVVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM253 activation kit by CRISPRa
GA118692 1 Kit

Human TMEM253 activation kit by CRISPRa

Sign In for Pricing
View Details
APE1 Mouse Monoclonal Antibody [12H4]
EM1801-13 100 µL

APE1 Mouse Monoclonal Antibody [12H4]

Sign In for Pricing
View Details
Coelenterazine IP
#10116-2 1x 250 µg

Coelenterazine IP

Sign In for Pricing
View Details
Tissue FFPE Sections, Pleura
CS708280 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
COX5A (Center) Rabbit Polyclonal Antibody
AP51032PU-N 400 µL

COX5A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sarm1 Mouse Gene Knockout Kit (CRISPR)
KN515299 1 Kit

Sarm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details