Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufs1 Peptide - N-terminal region

Ndufs1 Peptide - N-terminal region

Product Specifications

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufs1 Rabbit Polyclonal Antibody (orb330869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q66HF1

Preservative

Lyophilized powder

AA Sequence

VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Tyrosine Phosphatase (PEST, PTP-PEST)
P9109-21 100 µL

Protein Tyrosine Phosphatase (PEST, PTP-PEST)

Sign In for Pricing
View Details
KRT80 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1178605 3x 1.0 µg

KRT80 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IGLON5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
24694124 3x 1.0µg DNA

IGLON5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
PGBD3 antibody
70R-1365 100 ug

PGBD3 antibody

Sign In for Pricing
View Details
TRNAQ28 Adenovirus (Human)
48298051 1.0 mL

TRNAQ28 Adenovirus (Human)

Sign In for Pricing
View Details
Anti-Prokineticin Receptor 2 (PKR2) Polyclonal antibody
FY-AB34326-01 1 mL

Anti-Prokineticin Receptor 2 (PKR2) Polyclonal antibody

Sign In for Pricing
View Details