Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufs1 Peptide - N-terminal region

Ndufs1 Peptide - N-terminal region

Product Specifications

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufs1 Rabbit Polyclonal Antibody (orb330869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q66HF1

Preservative

Lyophilized powder

AA Sequence

VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG6 siRNA (Human)
MBS8226298-01 15 nmol

COG6 siRNA (Human)

Sign In for Pricing
View Details
COG6 siRNA (Human)
MBS8226298-02 30 nmol

COG6 siRNA (Human)

Sign In for Pricing
View Details
COG6 siRNA (Human)
MBS8226298-03 5x 30 nmol

COG6 siRNA (Human)

Sign In for Pricing
View Details
Ethyl-L-NIO (hydrochloride)
C4663-50 50 mg

Ethyl-L-NIO (hydrochloride)

Sign In for Pricing
View Details
Cytl1 Rat Pre-designed siRNA Set A
HY-RS24294 1 Set

Cytl1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
DPYD CRISPR Activation Plasmid (h)
sc-403396-ACT 20 µg

DPYD CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details