Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phkg1 Peptide - N-terminal region

Phkg1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PHKIN01, Phkg

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Phkg1 Rabbit Polyclonal Antibody (orb583259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

P13286

Preservative

Lyophilized powder

AA Sequence

NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A4GALT Antibody (N-term) Blocking peptide
MBS9217428-01 0.5 mg

A4GALT Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
A4GALT Antibody (N-term) Blocking peptide
MBS9217428-02 5x 0.5 mg

A4GALT Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
PER3 Mouse mAb
64074 100 µL

PER3 Mouse mAb

Sign In for Pricing
View Details
DHEA 3 Sulfate (Dehydroepiandrosterone Sulfate, DHEAS) discontinued
D3225-25D 1 mL

DHEA 3 Sulfate (Dehydroepiandrosterone Sulfate, DHEAS) discontinued

Sign In for Pricing
View Details
Nudcd3 Mouse shRNA Plasmid (Locus ID 209586)
TL513013 1 Kit

Nudcd3 Mouse shRNA Plasmid (Locus ID 209586)

Sign In for Pricing
View Details
Rabbit Monoclonal GOLM1 Antibody (005)
NBP2-90163-100ul 100 µL

Rabbit Monoclonal GOLM1 Antibody (005)

Sign In for Pricing
View Details