Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phkg1 Peptide - N-terminal region

Phkg1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PHKIN01, Phkg

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Phkg1 Rabbit Polyclonal Antibody (orb583259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

P13286

Preservative

Lyophilized powder

AA Sequence

NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas fluorescens DNA polymerase III subunit alpha (dnaE), partial
MBS1345724 Inquire

Recombinant Pseudomonas fluorescens DNA polymerase III subunit alpha (dnaE), partial

Sign In for Pricing
View Details
N- (3-Acetylphenyl) benzamide
sc-329244 500 mg

N- (3-Acetylphenyl) benzamide

Sign In for Pricing
View Details
P2RX3 Rabbit pAb
E45R19540N 50 ul

P2RX3 Rabbit pAb

Sign In for Pricing
View Details
2,4,6-Trifluoropyrimidine
289842-01 500 mg

2,4,6-Trifluoropyrimidine

Sign In for Pricing
View Details
2,4,6-Trifluoropyrimidine
289842-02 1 g

2,4,6-Trifluoropyrimidine

Sign In for Pricing
View Details
2,4,6-Trifluoropyrimidine
289842-03 2 g

2,4,6-Trifluoropyrimidine

Sign In for Pricing
View Details