Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rras Peptide - C-terminal region

Rras Peptide - C-terminal region

Product Specifications

Product Name Alternative

P23

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rras Rabbit Polyclonal Antibody (orb583280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D3Z8L7

Preservative

Lyophilized powder

AA Sequence

ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPGK-Fluc-RBM17-3UTR-hRluc-Neo Plasmid
PVT69070 2 µg

PPGK-Fluc-RBM17-3UTR-hRluc-Neo Plasmid

Sign In for Pricing
View Details
KRT71 Rabbit Polyclonal Antibody (BF405)
orb2496160 100 µL

KRT71 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
COPS8 Antibody - N-terminal region
ARP52241_P050-25UL 25 µL

COPS8 Antibody - N-terminal region

Sign In for Pricing
View Details
Sema3A Polyclonal Antibody Bio Conjugated
C90523Bio 100 µL

Sema3A Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Ythdf2 3'UTR Lenti-reporter-Luc Vector
50638084 1.0 µg

Ythdf2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Monoclonal ErbB2/Her2 Antibody (H2M5B) [Allophycocyanin]
FAB9896A 0.1 mL

Mouse Monoclonal ErbB2/Her2 Antibody (H2M5B) [Allophycocyanin]

Sign In for Pricing
View Details