Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rras Peptide - C-terminal region

Rras Peptide - C-terminal region

Product Specifications

Product Name Alternative

P23

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rras Rabbit Polyclonal Antibody (orb583280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D3Z8L7

Preservative

Lyophilized powder

AA Sequence

ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IDH1 Rabbit Monoclonal Antibody
MA3188-.05 50 µL

Anti-IDH1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Zkscan4 sgRNA CRISPR Lentivector set (Mouse)
K3182101 3x 1.0 µg

Zkscan4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CMG1 (IFT74) (NM_001099222) Human Untagged Clone
SC316551 10 µg

CMG1 (IFT74) (NM_001099222) Human Untagged Clone

Sign In for Pricing
View Details
Human F11R qPCR Primer Pair
QH40073S 200 Tests

Human F11R qPCR Primer Pair

Sign In for Pricing
View Details
7-Hydroxy Coumarin
H9040-60 2.5 g

7-Hydroxy Coumarin

Sign In for Pricing
View Details
Recombinant mouse CD74 protein, N-His, Biotin Conjugated
bs-41374P-Biotin-01 20 µg

Recombinant mouse CD74 protein, N-His, Biotin Conjugated

Sign In for Pricing
View Details