Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD1 Peptide - C-terminal region

SAMD1 Peptide - C-terminal region

Product Specifications

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMD1 Rabbit Polyclonal Antibody (orb326683) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q6SPF0

Preservative

Lyophilized powder

AA Sequence

GKPALPGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Bromo-5,6-dihydro-11H-benzo[5,6]cyclohepta[1,2-b]pyridin-11-one
TRC-B645085-50MG 50 mg

8-Bromo-5,6-dihydro-11H-benzo[5,6]cyclohepta[1,2-b]pyridin-11-one

Sign In for Pricing
View Details
Manual Wheelchair BHBD-909
BHBD-909 1 Unit

Manual Wheelchair BHBD-909

Sign In for Pricing
View Details
CPA2 Antibody
KC-8183-01 50 μL

CPA2 Antibody

Sign In for Pricing
View Details
CPA2 Antibody
KC-8183-02 100 µL

CPA2 Antibody

Sign In for Pricing
View Details
CPA2 Antibody
KC-8183-03 1 mL

CPA2 Antibody

Sign In for Pricing
View Details
DECR1 Antibody
KC-2089-01 50 μL

DECR1 Antibody

Sign In for Pricing
View Details