Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD1 Peptide - C-terminal region

SAMD1 Peptide - C-terminal region

Product Specifications

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMD1 Rabbit Polyclonal Antibody (orb326683) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q6SPF0

Preservative

Lyophilized powder

AA Sequence

GKPALPGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitroso Desethyl Blonanserin
TRC-N576880-100MG 100 mg

N-Nitroso Desethyl Blonanserin

Sign In for Pricing
View Details
AMIGO1 (NM_020703) Human Over-expression Lysate
LY402810 100 µg

AMIGO1 (NM_020703) Human Over-expression Lysate

Sign In for Pricing
View Details
Pter Mouse Gene Knockout Kit (CRISPR)
KN514164 1 Kit

Pter Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LELP1 Mouse Monoclonal Antibody [Clone ID: OTI5A5]
CF808570 100 µg

LELP1 Mouse Monoclonal Antibody [Clone ID: OTI5A5]

Sign In for Pricing
View Details
alpha+beta Synuclein Recombinant Rabbit Monoclonal Antibody [ST05-21]
ET1609-66 100 µL

alpha+beta Synuclein Recombinant Rabbit Monoclonal Antibody [ST05-21]

Sign In for Pricing
View Details
C20orf31 (EDEM2) Human Gene Knockout Kit (CRISPR)
KN400124 1 Kit

C20orf31 (EDEM2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details