Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-Hexatoxin-Hv1a

ω-Hexatoxin-Hv1a (ω-HXTX-Hv1a, ω-atracotoxin-Hv1a, ω-ACTX-Hv1a) has been isolated from the venom of Australian funnel web spiders. ω-Hexatoxin-Hv1a has been described to block mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca (v) ) currents.

Product Specifications

Specifications

Blocker of mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca (v) ) currents

Target

Insectisides

Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Peptide Number

ACT001

Disulfide Bonds

Cys4-Cys18; Cys11-Cys22; Cys17-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT4L Antibody
orb1244703 100 µL

DDIT4L Antibody

Sign In for Pricing
View Details
Recombinant Human BUB3 Protein, His, E.coli-20ug
QP11212-20ug 20ug

Recombinant Human BUB3 Protein, His, E.coli-20ug

Sign In for Pricing
View Details
KRTAP10-3 CRISPRa sgRNA lentivector (set of three targets)(Human)
26114121 3x 1.0µg DNA

KRTAP10-3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human TMPRSS11B Pre-designed siRNA Set A
SI017031A 1 Each

Human TMPRSS11B Pre-designed siRNA Set A

Sign In for Pricing
View Details
Livin Polyclonal Antibody, Cy3 Conjugated
bs-20731R-Cy3 100 µL

Livin Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human SYT15 (NM_031912) AAV Particle
RC221833A1V 250 µL

Human SYT15 (NM_031912) AAV Particle

Sign In for Pricing
View Details