Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-Hexatoxin-Hv1a

ω-Hexatoxin-Hv1a (ω-HXTX-Hv1a, ω-atracotoxin-Hv1a, ω-ACTX-Hv1a) has been isolated from the venom of Australian funnel web spiders. ω-Hexatoxin-Hv1a has been described to block mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca (v) ) currents.

Product Specifications

Specifications

Blocker of mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca (v) ) currents

Target

Insectisides

Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Peptide Number

ACT001

Disulfide Bonds

Cys4-Cys18; Cys11-Cys22; Cys17-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRFS1 Rabbit Polyclonal Antibody
orb258296 100 µg

UQCRFS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-Chd7 Plasmid
PVT53343 2 µg

pCMV-SPORT6-Chd7 Plasmid

Sign In for Pricing
View Details
MLLT4 (Afadin, ALL1-fused Gene from Chromosome 6 Protein, Protein AF-6, AF6, FLJ34371, RP3-431P23.3) (Biotin)
138137-Biotin 100 µL

MLLT4 (Afadin, ALL1-fused Gene from Chromosome 6 Protein, Protein AF-6, AF6, FLJ34371, RP3-431P23.3) (Biotin)

Sign In for Pricing
View Details
Aurora C (AURKC) Human Gene Knockout Kit (CRISPR)
KN413890 1 Kit

Aurora C (AURKC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAS1L CRISPR/Cas9 KO Plasmid (h)
sc-414096 20 µg

MAS1L CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Human FOLR1 (Folate Receptor 1) ELISA Kit
E-EL-H2662-01 24 Tests

Human FOLR1 (Folate Receptor 1) ELISA Kit

Sign In for Pricing
View Details