Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-Hexatoxin-Hv1a

ω-Hexatoxin-Hv1a (ω-HXTX-Hv1a, ω-atracotoxin-Hv1a, ω-ACTX-Hv1a) has been isolated from the venom of Australian funnel web spiders. ω-Hexatoxin-Hv1a has been described to block mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca (v) ) currents.

Product Specifications

Specifications

Blocker of mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca (v) ) currents

Target

Insectisides

Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Peptide Number

ACT001

Disulfide Bonds

Cys4-Cys18; Cys11-Cys22; Cys17-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUMA1 Antibody (Biotin)
orb401219-01 50 µg

NUMA1 Antibody (Biotin)

Sign In for Pricing
View Details
NUMA1 Antibody (Biotin)
orb401219-02 100 µg

NUMA1 Antibody (Biotin)

Sign In for Pricing
View Details
CEBPA Antibody - middle region : Biotin (ARP57937_P050-Biotin)
ARP57937_P050-Biotin 100 µL

CEBPA Antibody - middle region : Biotin (ARP57937_P050-Biotin)

Sign In for Pricing
View Details
Krtcap3-set siRNA/shRNA/RNAi Lentivector (Rat)
26226096 4x 500 ng

Krtcap3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Bovine Kynurenine-3-Monooxygenase ELISA Kit
OM621007 96 Strip Well

Bovine Kynurenine-3-Monooxygenase ELISA Kit

Sign In for Pricing
View Details
Human golgi protein 73, GP-73 ELISA KIT
E1432Hu-01 48 Well

Human golgi protein 73, GP-73 ELISA KIT

Sign In for Pricing
View Details