Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL Peptide - N-terminal region

GFRAL Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf144, GRAL, UNQ9356, bA360D14.1

UniProt

Q6UXV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GFRAL Rabbit Polyclonal Antibody (orb587018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997293

Preservative

Lyophilized powder

AA Sequence

TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH (PLA2G7) (NM_001168357) Human Tagged ORF Clone
RC230088 10 µg

PAFAH (PLA2G7) (NM_001168357) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-Bcl-xL (Thr115) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-5234R-PerCP-Cy5.5 100 µL

Phospho-Bcl-xL (Thr115) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
SUDD Polyclonal Antibody
E44H03296 100 µL

SUDD Polyclonal Antibody

Sign In for Pricing
View Details
ThiG Antibody
orb833385 2 mg

ThiG Antibody

Sign In for Pricing
View Details
Trem2 Mouse shRNA Plasmid (Locus ID 83433)
TL505406 1 Kit

Trem2 Mouse shRNA Plasmid (Locus ID 83433)

Sign In for Pricing
View Details
Human BRD8 knockdown cell line
ABC-KD1556 1 Vial

Human BRD8 knockdown cell line

Sign In for Pricing
View Details