Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAGHL Peptide - C-terminal region

HAGHL Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAGHL Rabbit Polyclonal Antibody (orb587023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q6PII5

Preservative

Lyophilized powder

AA Sequence

PVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ubiquitin D (UBD) ELISA Kit
AE12549MO-01 48 Tests

Mouse Ubiquitin D (UBD) ELISA Kit

Sign In for Pricing
View Details
Mouse Ubiquitin D (UBD) ELISA Kit
AE12549MO-02 96 Tests

Mouse Ubiquitin D (UBD) ELISA Kit

Sign In for Pricing
View Details
MTRNR2L10 HDR Plasmid (h)
sc-418860-HDR 20 µg

MTRNR2L10 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Toscana virus RNA-directed RNA polymerase L (L), partial
MBS1176443 Inquire

Recombinant Toscana virus RNA-directed RNA polymerase L (L), partial

Sign In for Pricing
View Details
(3,4-Dimethylphenyl) methanol
orb3030527-01 50 mg

(3,4-Dimethylphenyl) methanol

Sign In for Pricing
View Details
(3,4-Dimethylphenyl) methanol
orb3030527-02 200 mg

(3,4-Dimethylphenyl) methanol

Sign In for Pricing
View Details